PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010093955.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family G2-like
Protein Properties Length: 453aa    MW: 49050.4 Da    PI: 7.904
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010093955.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.91.9e-27170224156
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     k +++WtpeLH+rFv+aveqL G +kA+P++ile+m++++Lt+++++SHLQkYR++
  XP_010093955.1 170 KVKVDWTPELHRRFVQAVEQL-GVDKAVPSRILEIMGINCLTRHNIASHLQKYRSH 224
                     5689*****************.********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.77167226IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.6E-26168227IPR009057Homeodomain-like
SuperFamilySSF466898.06E-18168227IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-26170224IPR006447Myb domain, plants
PfamPF002491.4E-7173222IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MLAVSPLRNT TRDEKQGAVE SNFSINGFGG GGGDGFPDFA DSNLLDSIDF DDLFIGINDG  60
DVLPDLEMDP EILAEFSASG GKEYSDVKTS VSVERSADEH NSTKKEEDKI SGSNSRPTSS  120
KNEESSTVTV QNPISTTAAV AAKTKEGEKG GKKTSASSTA QSKNSQGKRK VKVDWTPELH  180
RRFVQAVEQL GVDKAVPSRI LEIMGINCLT RHNIASHLQK YRSHRKHLLA REAEAASWSQ  240
KRQMYGSAAV AAGKRDVSPW PAVAPTMGFP PMTPPPPVPP MHHHHFRPLH VWGHPTIDQS  300
LMHVWPPKHL PHSSNPPPPP PQAAWPPHPP HPDHSYWHSP HQRVPNALTP GTPCFPQPLA  360
TAARFATPPV PGIPPPHAMY KVDPGIGRLT TGQSGPHPLF DFLPSKESID AAIGDVLVKP  420
WLPLPLGLKP PSIDSVMVEL QRQGVPKVPP SCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A6e-15167222257ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093955.10.0Transcription activator GLK1
SwissprotQ9SIV31e-100GLK1_ARATH; Transcription activator GLK1
TrEMBLW9QUY80.0W9QUY8_9R
STRINGVIT_12s0028g03100.t011e-174(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42423461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.14e-74GBF's pro-rich region-interacting factor 1